PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G26920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 399aa    MW: 42199 Da    PI: 9.7143
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G26920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1344.7e-4286162177
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                   +CqvegC+adls +k+y+ rhkvC +hskap v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrr++q
  OB08G26920.1  86 RCQVEGCNADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRRPQ 162
                   6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-3583148IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.52284161IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-4085164IPR004333Transcription factor, SBP-box
PfamPF031105.2E-3287160IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEIASGGGGG GAGGGSGGGG GEPXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXXXXRNK GKGVAAPAAP PPPPPRCQVE GCNADLSGIK NYYCRHKVCF MHSKAPRVVV  120
AGLEQRFCQQ CSRFHLLPEF DQGKRSCRRR LAGHNERRRR PQMPLASRYG RIAASLGEHR  180
RFRSFTLDFS YPRVPSSVRD AWTAIRPGDR VAGGIQWHGN LTHPHSSAVA GYGAHAYNSQ  240
GSSSSGPPVF SGPSLPPGGS FTGVGAATDS SCALSLLSTQ PWDAATHRAA ASHNRAAAMS  300
TTASFDGNPV APSAMASSYM APSPWAGSRG HEGGGRSMPH QLPHEVSLDG VHPGPSHHAQ  360
FSGELELALQ GNGPAPAPRI DPGSGSTFDQ GSNTMDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-29871601184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1415SGGGGGGAGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071910.0AK107191.1 Oryza sativa Japonica Group cDNA clone:002-125-A04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695661.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ7EXZ20.0SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLJ3MUB10.0J3MUB1_ORYBR; Uncharacterized protein
STRINGOB08G26920.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.14e-42squamosa promoter binding protein-like 9